Lineage for d6enta1 (6ent A:2-176)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774037Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2774038Superfamily b.17.1: PEBP-like [49777] (3 families) (S)
  5. 2774039Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins)
  6. 2774047Protein Phosphatidylethanolamine binding protein, PEBP [49779] (4 species)
  7. 2774061Species Norway rat (Rattus norvegicus) [TaxId:10116] [346223] (1 PDB entry)
  8. 2774062Domain d6enta1: 6ent A:2-176 [342701]
    Other proteins in same PDB: d6enta2
    automated match to d2iqxc_
    complexed with cl, zn

Details for d6enta1

PDB Entry: 6ent (more details), 2.66 Å

PDB Description: structure of the rat rkip variant delta143-146
PDB Compounds: (A:) Phosphatidylethanolamine-binding protein 1

SCOPe Domain Sequences for d6enta1:

Sequence, based on SEQRES records: (download)

>d6enta1 b.17.1.1 (A:2-176) Phosphatidylethanolamine binding protein, PEBP {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aadisqwagplslqevdeppqhalrvdyggvtvdelgkvltptqvmnrpssiswdgldpg
klytlvltdpdapsrkdpkfrewhhflvvnmkgndissgtvlseyvgsgppkdtglhryv
wlvyeqeqplncdepilsnksgkfkvesfrkkyhlgapvagtcfqaewddsvpkl

Sequence, based on observed residues (ATOM records): (download)

>d6enta1 b.17.1.1 (A:2-176) Phosphatidylethanolamine binding protein, PEBP {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aadisqwagplslqevdeppqhalrvdyggvtvdelgkvltptqvmnrpssiswdgldpg
klytlvltdpdapsrkdpkfrewhhflvvnmkgndissgtvlseyvgsgppkdtglhryv
wlvyeqeqplncdepsgkfkvesfrkkyhlgapvagtcfqaewddsvpkl

SCOPe Domain Coordinates for d6enta1:

Click to download the PDB-style file with coordinates for d6enta1.
(The format of our PDB-style files is described here.)

Timeline for d6enta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6enta2