Lineage for d6bdma_ (6bdm A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007940Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2007941Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2007942Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2008494Protein automated matches [190068] (9 species)
    not a true protein
  7. 2008534Species Human (Homo sapiens) [TaxId:9606] [189507] (49 PDB entries)
  8. 2008589Domain d6bdma_: 6bdm A: [342686]
    automated match to d1w0ea_
    complexed with hem, y83

Details for d6bdma_

PDB Entry: 6bdm (more details), 2.6 Å

PDB Description: crystal structure of human cyp3a4 bound to an inhibitor
PDB Compounds: (A:) cytochrome p450 3a4

SCOPe Domain Sequences for d6bdma_:

Sequence, based on SEQRES records: (download)

>d6bdma_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdp
dmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvp
iiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfvent
kkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtqkh
rvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyelathpdv
qqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmf
ipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrf
almnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesr

Sequence, based on observed residues (ATOM records): (download)

>d6bdma_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdp
dmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvp
iiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfvent
kkfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledvdflqlm
idsqnshkalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidavlp
nkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmipsya
lhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalirvl
qnfsfkpcketqiplklslggllqpekpvvlkvesr

SCOPe Domain Coordinates for d6bdma_:

Click to download the PDB-style file with coordinates for d6bdma_.
(The format of our PDB-style files is described here.)

Timeline for d6bdma_: