Lineage for d6bcza_ (6bcz A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2331534Protein automated matches [190068] (10 species)
    not a true protein
  7. 2331553Species Human (Homo sapiens) [TaxId:9606] [189507] (64 PDB entries)
  8. 2331573Domain d6bcza_: 6bcz A: [342683]
    automated match to d1w0ea_
    complexed with d7y, hem

Details for d6bcza_

PDB Entry: 6bcz (more details), 2.23 Å

PDB Description: crystal structure of human cyp3a4 bound to an inhibitor
PDB Compounds: (A:) cytochrome p450 3a4

SCOPe Domain Sequences for d6bcza_:

Sequence, based on SEQRES records: (download)

>d6bcza_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
thshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitd
pdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemv
piiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfven
tkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtqk
hrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyelathpd
vqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingm
fipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmr
falmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesr

Sequence, based on observed residues (ATOM records): (download)

>d6bcza_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
thshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitd
pdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemv
piiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfven
tkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledvdf
lqlmidsqnsshkalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeei
davlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvm
ipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmkla
lirvlqnfsfkpcketqiplklslggllqpekpvvlkvesr

SCOPe Domain Coordinates for d6bcza_:

Click to download the PDB-style file with coordinates for d6bcza_.
(The format of our PDB-style files is described here.)

Timeline for d6bcza_: