Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (2 species) |
Species Streptomyces coelicolor [TaxId:1902] [56902] (22 PDB entries) identical sequence to Streptomyces lividans, TaxId: 1916 Uniprot Q54397 22-124 |
Domain d5vkec_: 5vke C: [342650] Other proteins in same PDB: d5vkea1, d5vkea2, d5vkeb1, d5vkeb2 automated match to d1r3jc_ complexed with 1em, f09, k |
PDB Entry: 5vke (more details), 2.37 Å
SCOPe Domain Sequences for d5vkec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vkec_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} wrcagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlapvt lwgrcvavvvmvagitsfglvtaalatwfvgqcqqq
Timeline for d5vkec_:
View in 3D Domains from other chains: (mouse over for more information) d5vkea1, d5vkea2, d5vkeb1, d5vkeb2 |