Lineage for d5vkec_ (5vke C:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252668Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2252669Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
  5. 2252670Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2252691Protein Potassium channel protein [56901] (2 species)
  7. 2252692Species Streptomyces coelicolor [TaxId:1902] [56902] (22 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 2252709Domain d5vkec_: 5vke C: [342650]
    Other proteins in same PDB: d5vkea1, d5vkea2, d5vkeb1, d5vkeb2
    automated match to d1r3jc_
    complexed with 1em, f09, k

Details for d5vkec_

PDB Entry: 5vke (more details), 2.37 Å

PDB Description: open conformation of kcsa deep-inactivated
PDB Compounds: (C:) pH-gated potassium channel KcsA

SCOPe Domain Sequences for d5vkec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vkec_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
wrcagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlapvt
lwgrcvavvvmvagitsfglvtaalatwfvgqcqqq

SCOPe Domain Coordinates for d5vkec_:

Click to download the PDB-style file with coordinates for d5vkec_.
(The format of our PDB-style files is described here.)

Timeline for d5vkec_: