Lineage for d5vk6a1 (5vk6 A:6-118)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353188Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (184 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 2353325Domain d5vk6a1: 5vk6 A:6-118 [342643]
    Other proteins in same PDB: d5vk6a2, d5vk6a3, d5vk6b1, d5vk6b2, d5vk6c_
    automated match to d1r3jb1
    complexed with 1em, f09, k; mutant

Details for d5vk6a1

PDB Entry: 5vk6 (more details), 2.25 Å

PDB Description: open conformation of kcsa non-inactivating e71a mutant
PDB Compounds: (A:) antibody heavy chain

SCOPe Domain Sequences for d5vk6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vk6a1 b.1.1.1 (A:6-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygranynekiq
kkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvss

SCOPe Domain Coordinates for d5vk6a1:

Click to download the PDB-style file with coordinates for d5vk6a1.
(The format of our PDB-style files is described here.)

Timeline for d5vk6a1: