Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Zobellia galactanivorans [TaxId:63186] [342330] (1 PDB entry) |
Domain d5olcb1: 5olc B:2-123 [342633] Other proteins in same PDB: d5olca2, d5olca3, d5olcb2, d5olcb3, d5olcc2, d5olcc3, d5olcd2, d5olcd3, d5olce2, d5olce3, d5olcf2, d5olcf3, d5olcg2, d5olcg3, d5olch2, d5olch3 automated match to d4hpna1 complexed with mg |
PDB Entry: 5olc (more details), 2.79 Å
SCOPe Domain Sequences for d5olcb1:
Sequence, based on SEQRES records: (download)
>d5olcb1 d.54.1.0 (B:2-123) automated matches {Zobellia galactanivorans [TaxId: 63186]} kikkiepyvishkldtpfyfsqwqydtrkicivkitlddgtygwgegygpaaviksgidf ftpfllgkeaighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkllnlpvsvll gg
>d5olcb1 d.54.1.0 (B:2-123) automated matches {Zobellia galactanivorans [TaxId: 63186]} kikkiepyvishklddtrkicivkitlddgtygwgegygpaaviksgidfftpfllgkea ighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkllnlpvsvllgg
Timeline for d5olcb1: