Lineage for d5olcb1 (5olc B:2-123)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948699Species Zobellia galactanivorans [TaxId:63186] [342330] (1 PDB entry)
  8. 2948701Domain d5olcb1: 5olc B:2-123 [342633]
    Other proteins in same PDB: d5olca2, d5olca3, d5olcb2, d5olcb3, d5olcc2, d5olcc3, d5olcd2, d5olcd3, d5olce2, d5olce3, d5olcf2, d5olcf3, d5olcg2, d5olcg3, d5olch2, d5olch3
    automated match to d4hpna1
    complexed with mg

Details for d5olcb1

PDB Entry: 5olc (more details), 2.79 Å

PDB Description: crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans
PDB Compounds: (B:) Galactonate dehydratase

SCOPe Domain Sequences for d5olcb1:

Sequence, based on SEQRES records: (download)

>d5olcb1 d.54.1.0 (B:2-123) automated matches {Zobellia galactanivorans [TaxId: 63186]}
kikkiepyvishkldtpfyfsqwqydtrkicivkitlddgtygwgegygpaaviksgidf
ftpfllgkeaighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkllnlpvsvll
gg

Sequence, based on observed residues (ATOM records): (download)

>d5olcb1 d.54.1.0 (B:2-123) automated matches {Zobellia galactanivorans [TaxId: 63186]}
kikkiepyvishklddtrkicivkitlddgtygwgegygpaaviksgidfftpfllgkea
ighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkllnlpvsvllgg

SCOPe Domain Coordinates for d5olcb1:

Click to download the PDB-style file with coordinates for d5olcb1.
(The format of our PDB-style files is described here.)

Timeline for d5olcb1: