Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein Cytochrome P450-NOR, nitric reductase [48270] (1 species) |
Species Fungus (Fusarium oxysporum) [TaxId:5507] [48271] (27 PDB entries) Uniprot P23295 |
Domain d5y5ha_: 5y5h A: [342623] automated match to d1geja_ complexed with gol, hem, no |
PDB Entry: 5y5h (more details), 1.5 Å
SCOPe Domain Sequences for d5y5ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y5ha_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} gapsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskv rtrqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvdd lleqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstare asaanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnat mvnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdk lvranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaelt tvfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif
Timeline for d5y5ha_: