SCOPe 2.06: Domain d5waeb_: 5wae B:

Lineage for d5waeb_ (5wae B:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (40 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [194613] (47 PDB entries)

8. Domain d5waeb_: 5wae B: [342592]
   automated match to d4neta_
   complexed with a1j

Details for d5waeb_

PDB Entry: 5wae, 1.8 Å

PDB Description: adc-7 in complex with boronic acid transition state inhibitor cr167

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5waeb_:

Sequence; same for both SEQRES and ATOM records:

>d5waeb_ e.3.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
ntpkdqeikklvdqnfkpllekydvpgmavgviqnnkkyemyyglqsvqdkkavnsntif
elgsvsklftataggyaknkgkisfddtpgkywkelkntpidqvnllqlatytsgnlalq
fpdevqtdqqvltffkdwkpknpigeyrqysnpsiglfgkvvalsmnkpfdqvlektifp
alglkhsyvnvpktqmqnyafgynqenqpirvnpgpldapaygvkstlpdmlsfihanln
pqkyptdiqrainethqgryqvntmyqalgweefsypatlqtlldsnseqivmkpnkvta
iskepsvkmyhktgstsgfgtyvvfipkeniglvmltnkripneerikaayvvlnaik

Timeline for d5waeb_:

• d5waeb_ is new in SCOPe 2.06-stable
  
• d5waeb_ appears in SCOPe 2.07
  
• d5waeb_ appears in the current release, SCOPe 2.08