Lineage for d5xopf_ (5xop F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996818Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1997383Protein automated matches [190064] (21 species)
    not a true protein
  7. 1997417Species Entamoeba histolytica [TaxId:885319] [342565] (1 PDB entry)
  8. 1997423Domain d5xopf_: 5xop F: [342566]
    Other proteins in same PDB: d5xopa2, d5xopb2, d5xopc2, d5xopd2, d5xope2
    automated match to d2m7ma_
    complexed with ca, mpd; mutant

Details for d5xopf_

PDB Entry: 5xop (more details), 1.9 Å

PDB Description: crystal structure of n-terminal domain ehcabp1 ef-2 mutant
PDB Compounds: (F:) Calcium-binding protein 1 (EhCBP1), putative

SCOPe Domain Sequences for d5xopf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xopf_ a.39.1.5 (F:) automated matches {Entamoeba histolytica [TaxId: 885319]}
maealfkeidvngdgavsyeevkafvskkraikneqllqlifksidkdgdgfidfeefak
fygsi

SCOPe Domain Coordinates for d5xopf_:

Click to download the PDB-style file with coordinates for d5xopf_.
(The format of our PDB-style files is described here.)

Timeline for d5xopf_: