SCOPe 2.08: Domain d5uknl1: 5ukn L:3-107

Lineage for d5uknl1 (5ukn L:3-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries)

8. Domain d5uknl1: 5ukn L:3-107 [342546]
   Other proteins in same PDB: d5uknh2, d5uknl2
   automated match to d1aqkl1
   complexed with cl

Details for d5uknl1

PDB Entry: 5ukn, 1.75 Å

PDB Description: structure of unliganded anti-gp120 cd4bs antibody dh522uca fab

PDB Compounds: (L:) DH522UCA Fab fragment light chain

SCOPe Domain Sequences for d5uknl1:

Sequence; same for both SEQRES and ATOM records:

>d5uknl1 b.1.1.0 (L:3-107) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
altqppsvskslgqsvtisctgtssdiggyngvswyqqhsgtaprlliyevskrpsgvsd
rfsgsksgntasltisglqaedeadyycgsyrsgstwvfgggtrltvlg

Timeline for d5uknl1:

• d5uknl1 first appeared in SCOPe 2.06
  
• d5uknl1 appears in SCOPe 2.07