Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) |
Family c.42.1.0: automated matches [191435] (1 protein) not a true family |
Protein automated matches [190626] (14 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [319911] (55 PDB entries) |
Domain d5wgma1: 5wgm A:440-798 [342525] Other proteins in same PDB: d5wgma2, d5wgmb2, d5wgmc2 automated match to d3c10c_ complexed with ah7, edo, k, peg, pge, zn |
PDB Entry: 5wgm (more details), 1.75 Å
SCOPe Domain Sequences for d5wgma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wgma1 c.42.1.0 (A:440-798) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} sspitglvydqrmmlhhnmwdshhpelpqrisrifsrheelrllsrchriparlateeel alchsskhisiikssehmkprdlnrlgdeynsifisnesytcallaagscfnsaqailtg qvrnavaivrppghhaekdtacgfcffntaaltaryaqsitreslrvlivdwdvhhgngt qhifeeddsvlyislhryedgaffpnsedanydkvglgkgrgynvnipwnggkmgdpeym aafhhlvmpiarefapelvlvsagfdaargdplggfqvtpegyahlthqlmslaagrvli ileggynltsisesmsmctsmllgdsppsldhltplktsatvsinnvlrahapfwsslr
Timeline for d5wgma1:
View in 3D Domains from other chains: (mouse over for more information) d5wgmb1, d5wgmb2, d5wgmc1, d5wgmc2 |