Lineage for d5trmg_ (5trm G:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209749Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2209750Protein automated matches [190038] (42 species)
    not a true protein
  7. 2209825Species Human (Homo sapiens) [TaxId:9606] [225745] (21 PDB entries)
  8. 2209884Domain d5trmg_: 5trm G: [342470]
    automated match to d5gcna_

Details for d5trmg_

PDB Entry: 5trm (more details), 2.9 Å

PDB Description: crystal structure of human gcn5 histone acetyltransferase domain
PDB Compounds: (G:) Histone acetyltransferase KAT2A

SCOPe Domain Sequences for d5trmg_:

Sequence, based on SEQRES records: (download)

>d5trmg_ d.108.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
giiefhvignsltpkanrrvllwlvglqnvfshqlprmpkeyiarlvfdpkhktlalikd
grviggicfrmfptqgfteivfcavtsneqvkgygthlmnhlkeyhikhnilyfltyade
yaigyfkkqgfskdikvpksrylgyikdyegatlmecelnpripyt

Sequence, based on observed residues (ATOM records): (download)

>d5trmg_ d.108.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
giiefhvignsltpnrrvllwlvglqnvfshqlprmpkeyiarlvfdpkhktlalikdgr
viggicfrmfptqgfteivfcavtsneqvkgygthlmnhlkeyhikhnilyfltyadeya
igyfkkqgfskdikvpksrylgyikdyegatlmecelnpripyt

SCOPe Domain Coordinates for d5trmg_:

Click to download the PDB-style file with coordinates for d5trmg_.
(The format of our PDB-style files is described here.)

Timeline for d5trmg_: