Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (42 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225745] (21 PDB entries) |
Domain d5trmg_: 5trm G: [342470] automated match to d5gcna_ |
PDB Entry: 5trm (more details), 2.9 Å
SCOPe Domain Sequences for d5trmg_:
Sequence, based on SEQRES records: (download)
>d5trmg_ d.108.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} giiefhvignsltpkanrrvllwlvglqnvfshqlprmpkeyiarlvfdpkhktlalikd grviggicfrmfptqgfteivfcavtsneqvkgygthlmnhlkeyhikhnilyfltyade yaigyfkkqgfskdikvpksrylgyikdyegatlmecelnpripyt
>d5trmg_ d.108.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} giiefhvignsltpnrrvllwlvglqnvfshqlprmpkeyiarlvfdpkhktlalikdgr viggicfrmfptqgfteivfcavtsneqvkgygthlmnhlkeyhikhnilyfltyadeya igyfkkqgfskdikvpksrylgyikdyegatlmecelnpripyt
Timeline for d5trmg_: