SCOPe 2.07: Domain d5nixd1: 5nix D:18-134

Lineage for d5nixd1 (5nix D:18-134)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d5nixd1: 5nix D:18-134 [342453]
   Other proteins in same PDB: d5nixa2, d5nixb2, d5nixc2, d5nixd2
   automated match to d3bova_
   complexed with 8yq, edo

Details for d5nixd1

PDB Entry: 5nix, 2.2 Å

PDB Description: structure of human programmed cell death 1 ligand 1 (pd-l1) with low molecular mass inhibitor

PDB Compounds: (D:) Programmed cell death 1 ligand 1

SCOPe Domain Sequences for d5nixd1:

Sequence; same for both SEQRES and ATOM records:

>d5nixd1 b.1.1.0 (D:18-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvq
hssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapy

Timeline for d5nixd1:

• d5nixd1 first appeared in SCOPe 2.06
  
• d5nixd1 does not appear in SCOPe 2.08