Lineage for d5ukql2 (5ukq L:108-209)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2364744Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (25 PDB entries)
  8. 2364767Domain d5ukql2: 5ukq L:108-209 [342421]
    Other proteins in same PDB: d5ukql1
    automated match to d1aqkl2
    complexed with gol

Details for d5ukql2

PDB Entry: 5ukq (more details), 2.1 Å

PDB Description: structure of unliganded anti-gp120 cd4bs antibody dh522.2 fab
PDB Compounds: (L:) DH522.2 Fab fragment light chain

SCOPe Domain Sequences for d5ukql2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ukql2 b.1.1.2 (L:108-209) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qpkasptvtlfppsseelqankatlvclisdfypgvvkvawkadgsavnagvetttpskq
snnkyaassylsltsdqwkshksyscqvthegstvektvapa

SCOPe Domain Coordinates for d5ukql2:

Click to download the PDB-style file with coordinates for d5ukql2.
(The format of our PDB-style files is described here.)

Timeline for d5ukql2: