Lineage for d5vq2b1 (5vq2 B:1-168)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868406Domain d5vq2b1: 5vq2 B:1-168 [342418]
    Other proteins in same PDB: d5vq2a2, d5vq2b2
    automated match to d4obea_
    complexed with gtp, mg

Details for d5vq2b1

PDB Entry: 5vq2 (more details), 1.96 Å

PDB Description: crystal structure of human wt-kras in complex with gtp
PDB Compounds: (B:) GTPase KRas

SCOPe Domain Sequences for d5vq2b1:

Sequence, based on SEQRES records: (download)

>d5vq2b1 c.37.1.8 (B:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

Sequence, based on observed residues (ATOM records): (download)

>d5vq2b1 c.37.1.8 (B:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydedsyrkqvvidgetclldildtdqymr
tgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlpsrtvdtkqaqdl
arsygipfietsaktrqgvddafytlvreirkhke

SCOPe Domain Coordinates for d5vq2b1:

Click to download the PDB-style file with coordinates for d5vq2b1.
(The format of our PDB-style files is described here.)

Timeline for d5vq2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vq2b2