Lineage for d5lu7d_ (5lu7 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908082Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2908083Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2908303Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2908304Protein automated matches [190547] (18 species)
    not a true protein
  7. 2908310Species Burkholderia pseudomallei [TaxId:272560] [189351] (5 PDB entries)
  8. 2908322Domain d5lu7d_: 5lu7 D: [342335]
    automated match to d3bjzd_
    complexed with edo, m7p, pg4, zn; mutant

Details for d5lu7d_

PDB Entry: 5lu7 (more details), 1.92 Å

PDB Description: heptose isomerase gmha mutant - d61a
PDB Compounds: (D:) Phosphoheptose isomerase

SCOPe Domain Sequences for d5lu7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lu7d_ c.80.1.0 (D:) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
menreltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaa
aaqhiagefvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvli
gystsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkiqeghlv
lghivcglvehsifgkq

SCOPe Domain Coordinates for d5lu7d_:

Click to download the PDB-style file with coordinates for d5lu7d_.
(The format of our PDB-style files is described here.)

Timeline for d5lu7d_: