Lineage for d5jzka1 (5jzk A:3-238)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184480Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2184481Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2184482Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2184486Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 2184492Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (177 PDB entries)
    Uniprot P42212
  8. 2184675Domain d5jzka1: 5jzk A:3-238 [342323]
    Other proteins in same PDB: d5jzka2, d5jzkb2
    automated match to d2fzua_
    complexed with cl, edo, gol, no3

Details for d5jzka1

PDB Entry: 5jzk (more details), 1.9 Å

PDB Description: the structure of ultra stable green fluorescent protein
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d5jzka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jzka1 d.22.1.1 (A:3-238) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvt
tlgygvlcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnr
ielkgidfkedgnilghkleynfnshnvyitadkqkngikayfkirhnvedgsvqladhy
qqntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagithgmdelyk

SCOPe Domain Coordinates for d5jzka1:

Click to download the PDB-style file with coordinates for d5jzka1.
(The format of our PDB-style files is described here.)

Timeline for d5jzka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jzka2