Lineage for d5j64a_ (5j64 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2212983Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2213185Protein automated matches [190229] (11 species)
    not a true protein
  7. 2213198Species Human (Homo sapiens) [TaxId:9606] [187292] (141 PDB entries)
  8. 2213232Domain d5j64a_: 5j64 A: [342283]
    automated match to d2xjxa_
    complexed with 6g7

Details for d5j64a_

PDB Entry: 5j64 (more details), 1.38 Å

PDB Description: crystal structure of hsp90-alpha n-domain in complex with 5-(2,4- dihydroxy-phenyl)-4-(2-fluoro-phenyl)-2,4-dihydro-[1,2,4]triazol-3- one
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d5j64a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j64a_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfve

SCOPe Domain Coordinates for d5j64a_:

Click to download the PDB-style file with coordinates for d5j64a_.
(The format of our PDB-style files is described here.)

Timeline for d5j64a_: