SCOPe 2.08: Domain d5gmqc1: 5gmq C:-1-105

Lineage for d5gmqc1 (5gmq C:-1-105)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d5gmqc1: 5gmq C:-1-105 [342259]
   Other proteins in same PDB: d5gmqb_, d5gmqc2
   automated match to d1dn0a1
   complexed with edo

Details for d5gmqc1

PDB Entry: 5gmq, 2.7 Å

PDB Description: structure of mers-cov rbd in complex with a fully human antibody mca1

PDB Compounds: (C:) MCA1 light chain

SCOPe Domain Sequences for d5gmqc1:

Sequence; same for both SEQRES and ATOM records:

>d5gmqc1 b.1.1.1 (C:-1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dveltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqygsspitfgqgtrlei

Timeline for d5gmqc1:

• d5gmqc1 first appeared in SCOPe 2.06
  
• d5gmqc1 appears in SCOPe 2.07