Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d5gmqc1: 5gmq C:-1-105 [342259] Other proteins in same PDB: d5gmqb_, d5gmqc2 automated match to d1dn0a1 complexed with edo |
PDB Entry: 5gmq (more details), 2.7 Å
SCOPe Domain Sequences for d5gmqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gmqc1 b.1.1.1 (C:-1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]} dveltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip drfsgsgsgtdftltisrlepedfavyycqqygsspitfgqgtrlei
Timeline for d5gmqc1: