Lineage for d5gmqc1 (5gmq C:-1-105)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (21 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (223 PDB entries)
  8. 2347557Domain d5gmqc1: 5gmq C:-1-105 [342259]
    Other proteins in same PDB: d5gmqc2
    automated match to d1dn0a1
    complexed with edo, man, nag

Details for d5gmqc1

PDB Entry: 5gmq (more details), 2.7 Å

PDB Description: structure of mers-cov rbd in complex with a fully human antibody mca1
PDB Compounds: (C:) MCA1 light chain

SCOPe Domain Sequences for d5gmqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gmqc1 b.1.1.1 (C:-1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dveltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqygsspitfgqgtrlei

SCOPe Domain Coordinates for d5gmqc1:

Click to download the PDB-style file with coordinates for d5gmqc1.
(The format of our PDB-style files is described here.)

Timeline for d5gmqc1: