SCOPe 2.08: Domain d6elkc2: 6elk C:86-194

Lineage for d6elkc2 (6elk C:86-194)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225669] (8 PDB entries)

8. Domain d6elkc2: 6elk C:86-194 [342248]
   Other proteins in same PDB: d6elka1, d6elkc1
   automated match to d3dc5a2
   complexed with gol, mn, so4; mutant

Details for d6elkc2

PDB Entry: 6elk, 1.65 Å

PDB Description: c.elegans mnsod-3 mutant - q142h

PDB Compounds: (C:) Superoxide dismutase [Mn] 2, mitochondrial

SCOPe Domain Sequences for d6elkc2:

Sequence; same for both SEQRES and ATOM records:

>d6elkc2 d.44.1.0 (C:86-194) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gepskelmdtikrdfgsldnlqkrlsditiavqgsgwgwlgyckkdkilkiatcanhdpl
egmvplfgidvwehayylqyknvrpdyvhaiwkianwkniserfanarq

Timeline for d6elkc2:

• d6elkc2 first appeared in SCOPe 2.06
  
• d6elkc2 appears in SCOPe 2.07