Class a: All alpha proteins [46456] (289 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (32 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225668] (5 PDB entries) |
Domain d6elkc1: 6elk C:1-85 [342247] Other proteins in same PDB: d6elka2, d6elkc2 automated match to d3dc5a1 complexed with gol, mn, so4; mutant |
PDB Entry: 6elk (more details), 1.65 Å
SCOPe Domain Sequences for d6elkc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6elkc1 a.2.11.0 (C:1-85) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} khtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaial qpalkfnggghinhsifwtnlakdg
Timeline for d6elkc1: