Lineage for d6b3sd2 (6b3s D:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756998Domain d6b3sd2: 6b3s D:108-213 [342237]
    Other proteins in same PDB: d6b3sa1, d6b3sa2, d6b3sb1, d6b3sb2, d6b3sb3, d6b3se1, d6b3se2, d6b3se3, d6b3si1, d6b3si2, d6b3si3
    automated match to d3b2ud2
    complexed with nag

Details for d6b3sd2

PDB Entry: 6b3s (more details), 2.8 Å

PDB Description: crystal structure of the fab fragment of necitumumab (fab11f8) in complex with domain iii from a cetuximab resistant variant of egfr (segfrd3-s468r)
PDB Compounds: (D:) Necitumumab Fab Light chain

SCOPe Domain Sequences for d6b3sd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b3sd2 b.1.1.0 (D:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrga

SCOPe Domain Coordinates for d6b3sd2:

Click to download the PDB-style file with coordinates for d6b3sd2.
(The format of our PDB-style files is described here.)

Timeline for d6b3sd2: