Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.5: L domain [52071] (6 proteins) this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain |
Protein automated matches [232361] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [232384] (6 PDB entries) |
Domain d6b3sa1: 6b3s A:311-480 [342229] Other proteins in same PDB: d6b3sa2, d6b3sb2, d6b3sb3, d6b3sd1, d6b3sd2, d6b3se2, d6b3se3, d6b3sg1, d6b3sg2, d6b3si2, d6b3si3, d6b3sk1, d6b3sk2, d6b3sl1, d6b3sl2 automated match to d1moxa2 complexed with bma, man, nag |
PDB Entry: 6b3s (more details), 2.8 Å
SCOPe Domain Sequences for d6b3sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6b3sa1 c.10.2.5 (A:311-480) automated matches {Human (Homo sapiens) [TaxId: 9606]} kvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldi lktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrslk eisdgdviisgnknlcyantinwkklfgtsgqktkiirnrgensckatgq
Timeline for d6b3sa1: