Lineage for d6b8ba_ (6b8b A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 2452181Species Escherichia coli [TaxId:83333] [334882] (5 PDB entries)
  8. 2452183Domain d6b8ba_: 6b8b A: [342225]
    automated match to d4wbsa_
    complexed with adp, czj, mg

Details for d6b8ba_

PDB Entry: 6b8b (more details), 1.95 Å

PDB Description: e. coli lptb in complex with adp and a novobiocin derivative
PDB Compounds: (A:) Lipopolysaccharide export system ATP-binding protein LptB

SCOPe Domain Sequences for d6b8ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b8ba_ c.37.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
atltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagnii
iddddisllplhararrgigylpqeasifrrlsvydnlmavlqirddlsaeqredranel
meefhiehlrdsmgqslsggerrrveiaralaanpkfilldepfagvdpisvidikriie
hlrdsglgvlitdhnvretlavcerayivsqghliahgtpteilqdehvkrvy

SCOPe Domain Coordinates for d6b8ba_:

Click to download the PDB-style file with coordinates for d6b8ba_.
(The format of our PDB-style files is described here.)

Timeline for d6b8ba_: