Lineage for d5xmsb_ (5xms B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132795Species Plasmodium vivax [TaxId:126793] [261543] (17 PDB entries)
  8. 2298915Domain d5xmsb_: 5xms B: [342216]
    automated match to d4pffa_
    complexed with 8b3, cl, plg

Details for d5xmsb_

PDB Entry: 5xms (more details), 2.45 Å

PDB Description: plasmodium vivax shmt bound with plp-glycine and gs498
PDB Compounds: (B:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d5xmsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xmsb_ c.67.1.0 (B:) automated matches {Plasmodium vivax [TaxId: 126793]}
mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
gnaqlqqlkqevvtwagalpfp

SCOPe Domain Coordinates for d5xmsb_:

Click to download the PDB-style file with coordinates for d5xmsb_.
(The format of our PDB-style files is described here.)

Timeline for d5xmsb_:

  • d5xmsb_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-30