Lineage for d5wq2a1 (5wq2 A:22-202)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2058159Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2058160Protein automated matches [190438] (24 species)
    not a true protein
  7. 2270184Species Enterovirus a71 [TaxId:39054] [313489] (5 PDB entries)
  8. 2298911Domain d5wq2a1: 5wq2 A:22-202 [342212]
    Other proteins in same PDB: d5wq2a2
    automated match to d3r0fa_
    complexed with ag7, so4

Details for d5wq2a1

PDB Entry: 5wq2 (more details), 1.39 Å

PDB Description: crystal structure of 3c protease from a mild human enterovirus 71 in complex with rupintrivir
PDB Compounds: (A:) 3C protein

SCOPe Domain Sequences for d5wq2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wq2a1 b.47.1.0 (A:22-202) automated matches {Enterovirus a71 [TaxId: 39054]}
gpsldfalsllrrnirqvqtdqghftmlgirdrlavlprhsqpgktiwiehklvnvldav
elvdeqgvdleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdvv
qygflnlsgkpthrtmmynfptkagqcggvvtsvgkiigihiggngrqgfcaglkrsyfa
s

SCOPe Domain Coordinates for d5wq2a1:

Click to download the PDB-style file with coordinates for d5wq2a1.
(The format of our PDB-style files is described here.)

Timeline for d5wq2a1:

  • d5wq2a1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5wq2a2