Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.241: Ribosome binding domain-like [100965] (2 superfamilies) beta-(2)-alpha(2)-beta(2); 2 layers: beta/alpha; antiparallel beta-sheet: order 1243; topological similarity to the common core of ribosomal proteins L23 and L15e |
Superfamily d.241.2: Trigger factor ribosome-binding domain [102735] (2 families) automatically mapped to Pfam PF05697 |
Family d.241.2.0: automated matches [256436] (1 protein) not a true family |
Protein automated matches [256437] (3 species) not a true protein |
Species Escherichia coli [TaxId:562] [342130] (2 PDB entries) |
Domain d5owjb1: 5owj B:1-131 [342209] Other proteins in same PDB: d5owja2, d5owja3, d5owjb2, d5owjb3 automated match to d1w26a2 |
PDB Entry: 5owj (more details)
SCOPe Domain Sequences for d5owjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5owjb1 d.241.2.0 (B:1-131) automated matches {Escherichia coli [TaxId: 562]} mqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkvpmnivaqryga svrqdvlgdlmsrnfidaiikekinpagaptyvpgeyklgedftysvefevypevelqgl eaievekpive
Timeline for d5owjb1: