Lineage for d5y9la_ (5y9l A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2058159Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2058160Protein automated matches [190438] (24 species)
    not a true protein
  7. 2058190Species Human (Homo sapiens) [TaxId:9606] [187421] (73 PDB entries)
  8. 2298907Domain d5y9la_: 5y9l A: [342208]
    automated match to d2qxia_
    complexed with 8r3, cl

Details for d5y9la_

PDB Entry: 5y9l (more details), 2.15 Å

PDB Description: human kallikrein 7 in complex with 1,3,6-trisubstituted 1,4-diazepane- 7-one
PDB Compounds: (A:) Kallikrein-7

SCOPe Domain Sequences for d5y9la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y9la_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iidgapcargshpwqvallsgnqlhcggvlvnerwvltaahckmneytvhlgsdtlgdrr
aqrikasksfrhpgystqthvndlmlvklnsqarlssmvkkvrlpsrceppgttctvsgw
gtttspdvtfpsdlmcvdvklispqdctkvykdllensmlcagipdskknacngdsggpl
vcrgtlqglvswgtfpcgqpndpgvytqvckftkwindtmkkhr

SCOPe Domain Coordinates for d5y9la_:

Click to download the PDB-style file with coordinates for d5y9la_.
(The format of our PDB-style files is described here.)

Timeline for d5y9la_:

  • d5y9la_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-30