Lineage for d5y8tb_ (5y8t B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (68 species)
    not a true protein
  7. 2298637Species Bacillus subtilis [TaxId:655816] [341938] (4 PDB entries)
  8. 2298905Domain d5y8tb_: 5y8t B: [342206]
    automated match to d1yg2a_
    complexed with hc4

Details for d5y8tb_

PDB Entry: 5y8t (more details), 2 Å

PDB Description: crystal structure of bacillus subtilis padr in complex with p-coumaric acid
PDB Compounds: (B:) Transcriptional regulator

SCOPe Domain Sequences for d5y8tb_:

Sequence, based on SEQRES records: (download)

>d5y8tb_ a.4.5.0 (B:) automated matches {Bacillus subtilis [TaxId: 655816]}
rvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfitfrttiq
gtklekkmytltdsgkqelhdwlirhqpipetvkdefmlkayfisslsrqeasdlftdql
lkrkaklsdlqgsyeklmasaepmsfsspdfghylvltkalereknyvswlesilamide

Sequence, based on observed residues (ATOM records): (download)

>d5y8tb_ a.4.5.0 (B:) automated matches {Bacillus subtilis [TaxId: 655816]}
rvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfitfrtkkm
ytltdsgkqelhdwlirhqpipetvkdefmlkayfisslsrqeasdlftdqllkrkakls
dlqgsyeklmapmsfsspdfghylvltkalereknyvswlesilamide

SCOPe Domain Coordinates for d5y8tb_:

Click to download the PDB-style file with coordinates for d5y8tb_.
(The format of our PDB-style files is described here.)

Timeline for d5y8tb_:

  • d5y8tb_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-30