Lineage for d5y4rd_ (5y4r D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055232Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2055524Superfamily b.45.2: PilZ domain-like [141371] (2 families) (S)
  5. 2055525Family b.45.2.1: PilZ domain [141372] (3 protein domains)
    Pfam PF07238
  6. 2055526Protein Hypothetical protein PA4608 [141375] (1 species)
  7. 2055527Species Pseudomonas aeruginosa [TaxId:287] [141376] (4 PDB entries)
    Uniprot Q9HVI1 1-125
  8. 2298894Domain d5y4rd_: 5y4r D: [342195]
    automated match to d1ywua1
    complexed with c2e, so4

Details for d5y4rd_

PDB Entry: 5y4r (more details), 2.3 Å

PDB Description: structure of a methyltransferase complex
PDB Compounds: (D:) Cyclic diguanosine monophosphate-binding protein PA4608

SCOPe Domain Sequences for d5y4rd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y4rd_ b.45.2.1 (D:) Hypothetical protein PA4608 {Pseudomonas aeruginosa [TaxId: 287]}
derrrfhriafdadseilqgerrwevllhdvslhgilvgqpqdwngdpqrpfearlylgl
dvlirmeislawardgllgfecqhidldsishlrrlvelnlgdeellerelallvsahd

SCOPe Domain Coordinates for d5y4rd_:

Click to download the PDB-style file with coordinates for d5y4rd_.
(The format of our PDB-style files is described here.)

Timeline for d5y4rd_:

  • d5y4rd_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-30