SCOPe 2.06: Domain d5y4rc_: 5y4r C:

Lineage for d5y4rc_ (5y4r C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.2: PilZ domain-like [141371] (2 families)

5. Family b.45.2.1: PilZ domain [141372] (3 proteins)
   Pfam PF07238

6. Protein Hypothetical protein PA4608 [141375] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141376] (4 PDB entries)
   Uniprot Q9HVI1 1-125

8. Domain d5y4rc_: 5y4r C: [342189]
   automated match to d1ywua1
   complexed with c2e, so4

Details for d5y4rc_

PDB Entry: 5y4r, 2.3 Å

PDB Description: structure of a methyltransferase complex

PDB Compounds: (C:) Cyclic diguanosine monophosphate-binding protein PA4608

SCOPe Domain Sequences for d5y4rc_:

Sequence; same for both SEQRES and ATOM records:

>d5y4rc_ b.45.2.1 (C:) Hypothetical protein PA4608 {Pseudomonas aeruginosa [TaxId: 287]}
derrrfhriafdadseilqgerrwevllhdvslhgilvgqpqdwngdpqrpfearlylgl
dvlirmeislawardgllgfecqhidldsishlrrlvelnlgdeellerelallvsah

Timeline for d5y4rc_:

• d5y4rc_ is new in SCOPe 2.06-stable
  
• d5y4rc_ appears in SCOPe 2.07
  
• d5y4rc_ appears in the current release, SCOPe 2.08