Lineage for d5xmqc_ (5xmq C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897670Species Plasmodium vivax [TaxId:126793] [261543] (24 PDB entries)
  8. 2897679Domain d5xmqc_: 5xmq C: [342187]
    automated match to d4pffa_
    complexed with 8a6, cl, plg

Details for d5xmqc_

PDB Entry: 5xmq (more details), 2.2 Å

PDB Description: plasmodium vivax shmt(c346a) bound with plp-glycine and mf011
PDB Compounds: (C:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d5xmqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xmqc_ c.67.1.0 (C:) automated matches {Plasmodium vivax [TaxId: 126793]}
mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
dvdavspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
gnaqlqqlkqevvtwagalpfp

SCOPe Domain Coordinates for d5xmqc_:

Click to download the PDB-style file with coordinates for d5xmqc_.
(The format of our PDB-style files is described here.)

Timeline for d5xmqc_: