Lineage for d5xkub2 (5xku B:105-209)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (765 PDB entries)
  8. 2352662Domain d5xkub2: 5xku B:105-209 [342180]
    Other proteins in same PDB: d5xkub1
    automated match to d1dn0a2
    complexed with nag

Details for d5xkub2

PDB Entry: 5xku (more details), 1.78 Å

PDB Description: crystal structure of hemagglutinin globular head from an h7n9 influenza virus in complex with a neutralizing antibody hnigga6
PDB Compounds: (B:) HNIgGA6 light chain

SCOPe Domain Sequences for d5xkub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xkub2 b.1.1.2 (B:105-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d5xkub2:

Click to download the PDB-style file with coordinates for d5xkub2.
(The format of our PDB-style files is described here.)

Timeline for d5xkub2: