Lineage for d5wqvb_ (5wqv B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2051200Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 protein domains)
    barrel, closed; n=5, S=10
  6. 2051392Protein automated matches [190206] (9 species)
    not a true protein
  7. 2298872Species Escherichia coli [TaxId:595496] [342173] (1 PDB entry)
  8. 2298876Domain d5wqvb_: 5wqv B: [342177]
    automated match to d4apva_
    mutant

Details for d5wqvb_

PDB Entry: 5wqv (more details), 1.97 Å

PDB Description: crystal structure of prib mutant - s55a
PDB Compounds: (B:) primosomal replication protein n

SCOPe Domain Sequences for d5wqvb_:

Sequence, based on SEQRES records: (download)

>d5wqvb_ b.40.4.3 (B:) automated matches {Escherichia coli [TaxId: 595496]}
tnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivaghenqa
ithsitvgsritvqgfischkaknglskmvlhaeqiel

Sequence, based on observed residues (ATOM records): (download)

>d5wqvb_ b.40.4.3 (B:) automated matches {Escherichia coli [TaxId: 595496]}
tnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivaghenqa
ithsitvgsritvqgfischkmvlhaeqiel

SCOPe Domain Coordinates for d5wqvb_:

Click to download the PDB-style file with coordinates for d5wqvb_.
(The format of our PDB-style files is described here.)

Timeline for d5wqvb_:

  • d5wqvb_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-30

View in 3D
Domains from other chains:
(mouse over for more information)
d5wqva_