Lineage for d5wqva_ (5wqv A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789537Protein automated matches [190206] (10 species)
    not a true protein
  7. 2789547Species Escherichia coli [TaxId:595496] [342173] (1 PDB entry)
  8. 2789548Domain d5wqva_: 5wqv A: [342174]
    automated match to d4apva_
    mutant

Details for d5wqva_

PDB Entry: 5wqv (more details), 1.97 Å

PDB Description: crystal structure of prib mutant - s55a
PDB Compounds: (A:) primosomal replication protein n

SCOPe Domain Sequences for d5wqva_:

Sequence, based on SEQRES records: (download)

>d5wqva_ b.40.4.3 (A:) automated matches {Escherichia coli [TaxId: 595496]}
tnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivaghenqa
ithsitvgsritvqgfischkaknglskmvlhaeqieli

Sequence, based on observed residues (ATOM records): (download)

>d5wqva_ b.40.4.3 (A:) automated matches {Escherichia coli [TaxId: 595496]}
tnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivaghenqa
ithsitvgsritvqgfischkskmvlhaeqieli

SCOPe Domain Coordinates for d5wqva_:

Click to download the PDB-style file with coordinates for d5wqva_.
(The format of our PDB-style files is described here.)

Timeline for d5wqva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5wqvb_