Lineage for d5veqb1 (5veq B:42-451)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132667Species Mouse (Mus musculus) [TaxId:10090] [188700] (8 PDB entries)
  8. 2298861Domain d5veqb1: 5veq B:42-451 [342162]
    Other proteins in same PDB: d5veqa2, d5veqb2
    automated match to d3e2ya_
    complexed with ca, epe, gol, pg4, pge, pmp

Details for d5veqb1

PDB Entry: 5veq (more details), 2.26 Å

PDB Description: mouse kynurenine aminotransferase iii, re-refinement of the pdb structure 3e2y
PDB Compounds: (B:) Kynurenine--oxoglutarate transaminase 3

SCOPe Domain Sequences for d5veqb1:

Sequence, based on SEQRES records: (download)

>d5veqb1 c.67.1.0 (B:42-451) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nakriegldsnvwveftklaadpsvvnlgqgfpdisppsyvkeelskaafidnmnqytrg
fghpalvkalsclygkiyqrqidpneeilvavgaygslfnsiqglvdpgdeviimvpfyd
cyepmvrmagavpvfiplrskptdgmkwtssdwtfdpreleskfssktkaiilntphnpl
gkvytrqelqviadlcvkhdtlcisdevyewlvytghthvkiatlpgmwertitigsagk
tfsvtgwklgwsigpahlikhlqtvqqnsfytcatplqaalaeafwidikrmddpecyfn
slpkelevkrdrmvrllnsvglkpivpdggyfiiadvsslgadlsdmnsdepydykfvkw
mtkhkkltaipvsafcdskskphfeklvrfcfikkdstldaaeeifrawn

Sequence, based on observed residues (ATOM records): (download)

>d5veqb1 c.67.1.0 (B:42-451) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nakriegldsnvwvefdpsvvnlgqgfpdisppsyvkeelskaafidnmnqytrgfghpa
lvkalsclygkiyqrqidpneeilvavgaygslfnsiqglvdpgdeviimvpfydcyepm
vrmagavpvfiplrskptdgmkwtssdwtfdpreleskfssktkaiilntphnplgkvyt
rqelqviadlcvkhdtlcisdevyewlvytghthvkiatlpgmwertitigsagktfsvt
gwklgwsigpahlikhlqtvqqnsfytcatplqaalaeafwidikrmddpecyfnslpke
levkrdrmvrllnsvglkpivpdggyfiiadvsslepydykfvkwmtkhkkltaipvsaf
cdskskphfeklvrfcfikkdstldaaeeifrawn

SCOPe Domain Coordinates for d5veqb1:

Click to download the PDB-style file with coordinates for d5veqb1.
(The format of our PDB-style files is described here.)

Timeline for d5veqb1:

  • d5veqb1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5veqb2