Lineage for d5wdza_ (5wdz A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2156493Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2156494Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2156495Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 protein domains)
  6. 2156529Protein Interleukin-8, IL-8 [54119] (1 species)
  7. 2156530Species Human (Homo sapiens) [TaxId:9606] [54120] (12 PDB entries)
  8. 2298859Domain d5wdza_: 5wdz A: [342160]
    automated match to d1qe6d_

Details for d5wdza_

PDB Entry: 5wdz (more details)

PDB Description: structure of monomeric interleukin-8 (1-66)
PDB Compounds: (A:) interleukin-8

SCOPe Domain Sequences for d5wdza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wdza_ d.9.1.1 (A:) Interleukin-8, IL-8 {Human (Homo sapiens) [TaxId: 9606]}
sakelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqr
vvekfl

SCOPe Domain Coordinates for d5wdza_:

Click to download the PDB-style file with coordinates for d5wdza_.
(The format of our PDB-style files is described here.)

Timeline for d5wdza_:

  • d5wdza_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-30