Lineage for d5w14d_ (5w14 D:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (40 species)
    not a true protein
  7. 2218833Species Acinetobacter baumannii [TaxId:470] [194613] (42 PDB entries)
  8. 2298856Domain d5w14d_: 5w14 D: [342157]
    automated match to d4neta_
    complexed with 9tj

Details for d5w14d_

PDB Entry: 5w14 (more details), 1.88 Å

PDB Description: adc-7 in complex with boronic acid transition state inhibitor s03043
PDB Compounds: (D:) Beta-lactamase

SCOPe Domain Sequences for d5w14d_:

Sequence, based on SEQRES records: (download)

>d5w14d_ e.3.1.0 (D:) automated matches {Acinetobacter baumannii [TaxId: 470]}
dqeikklvdqnfkpllekydvpgmavgviqnnkkyemyyglqsvqdkkavnsntifelgs
vsklftataggyaknkgkisfddtpgkywkelkntpidqvnllqlatytsgnlalqfpde
vqtdqqvltffkdwkpknpigeyrqysnpsiglfgkvvalsmnkpfdqvlektifpalgl
khsyvnvpktqmqnyafgynqenqpirvnpgpldapaygvkstlpdmlsfihanlnpqky
ptdiqrainethqgryqvntmyqalgweefsypatlqtlldsnseqivmkpnkvtaiske
psvkmyhktgstsgfgtyvvfipkeniglvmltnkripneerikaayvvlnai

Sequence, based on observed residues (ATOM records): (download)

>d5w14d_ e.3.1.0 (D:) automated matches {Acinetobacter baumannii [TaxId: 470]}
dqeikklvdqnfkpllekydvpgmavgviqnnkkyemyyglqsvqdkkavnsntifelgs
vsklftataggyaknkgkisfddtpgkywkelkntpidqvnllqlatytsgnlalqfpde
vqtdqqvltffkdwkpknpigeyrqysnpsiglfgkvvalsmnkpfdqvlektifpalgl
khsyvnvpktqmqnyafgynqenqpirvnpgpldapaygvkstlpdmlsfihanlnpqky
ptdiqrainethqgryqvntmyqalgweefsypatlqtlldsnseqivmkpnkvtaiske
pvkmyhktgstsgfgtyvvfipkeniglvmltnkripneerikaayvvlnai

SCOPe Domain Coordinates for d5w14d_:

Click to download the PDB-style file with coordinates for d5w14d_.
(The format of our PDB-style files is described here.)

Timeline for d5w14d_:

  • d5w14d_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-30