Lineage for d5w12b_ (5w12 B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (40 species)
    not a true protein
  7. 2218833Species Acinetobacter baumannii [TaxId:470] [194613] (42 PDB entries)
  8. 2298851Domain d5w12b_: 5w12 B: [342152]
    automated match to d4neta_
    complexed with 9tg

Details for d5w12b_

PDB Entry: 5w12 (more details), 1.88 Å

PDB Description: adc-7 in complex with boronic acid transition state inhibitor ec04
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5w12b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w12b_ e.3.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
tpkdqeikklvdqnfkpllekydvpgmavgviqnnkkyemyyglqsvqdkkavnsntife
lgsvsklftataggyaknkgkisfddtpgkywkelkntpidqvnllqlatytsgnlalqf
pdevqtdqqvltffkdwkpknpigeyrqysnpsiglfgkvvalsmnkpfdqvlektifpa
lglkhsyvnvpktqmqnyafgynqenqpirvnpgpldapaygvkstlpdmlsfihanlnp
qkyptdiqrainethqgryqvntmyqalgweefsypatlqtlldsnseqivmkpnkvtai
skepsvkmyhktgstsgfgtyvvfipkeniglvmltnkripneerikaayvvlnaikk

SCOPe Domain Coordinates for d5w12b_:

Click to download the PDB-style file with coordinates for d5w12b_.
(The format of our PDB-style files is described here.)

Timeline for d5w12b_:

  • d5w12b_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-30