Lineage for d5ouhc_ (5ouh C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2073793Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 protein domains)
    automatically mapped to Pfam PF02931
  6. 2073887Protein automated matches [190922] (2 species)
    not a true protein
  7. 2074149Species Human (Homo sapiens) [TaxId:9606] [189722] (5 PDB entries)
  8. 2298848Domain d5ouhc_: 5ouh C: [342149]
    automated match to d5afna_
    complexed with bma, dms, l0b, man, nag

Details for d5ouhc_

PDB Entry: 5ouh (more details), 2.5 Å

PDB Description: humanized alpha-achbp (acetylcholine binding protein) in complex with lobeline.
PDB Compounds: (C:) acetylcholine binding protein

SCOPe Domain Sequences for d5ouhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ouhc_ b.96.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvviwlqmswt
dhylqwnvseypgvkqvsvpisslwkpdillynaierpevltpqlalvnssghvqylpsi
rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
serfyecckepypdvtftvtfrkkg

SCOPe Domain Coordinates for d5ouhc_:

Click to download the PDB-style file with coordinates for d5ouhc_.
(The format of our PDB-style files is described here.)

Timeline for d5ouhc_:

  • d5ouhc_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-30