SCOPe 2.08: Domain d5ofnb_: 5ofn B:

Lineage for d5ofnb_ (5ofn B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.262: PriB N-terminal domain-like [140913] (1 superfamily)
   multihelical bundle; contains buried central helix; also includes the PriA interface-forming insert subdomain (alpha+beta)

4. Superfamily a.262.1: PriB N-terminal domain-like [140914] (1 family)

5. Family a.262.1.1: PriB N-terminal domain-like [140915] (2 proteins)

6. Protein automated matches [342146] (1 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [342147] (1 PDB entry)

8. Domain d5ofnb_: 5ofn B: [342148]
   Other proteins in same PDB: d5ofna_
   automated match to d1zt2b1
   complexed with zn

Details for d5ofnb_

PDB Entry: 5ofn, 3.01 Å

PDB Description: crystal structure of the heterotrimeric prislx primase from s. solfataricus.

PDB Compounds: (B:) DNA primase large subunit PriL,PriL-X fusion protein

SCOPe Domain Sequences for d5ofnb_:

Sequence; same for both SEQRES and ATOM records:

>d5ofnb_ a.262.1.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
ldvkkypfikslddelkkygggitltdlllnsttlidqakdriqktksgdelphyvsyne
pvlvfyttllslailndvklirryayaeakqfrsllhteneenlleisklldlkinrcdp
ikfylekkrriiqkefcvhfidylkytkdlkedwklsgqilhkgyvyldknqligliaes
ikskivemirplnlkeipeklkslie

Timeline for d5ofnb_:

• d5ofnb_ first appeared in SCOPe 2.06
  
• d5ofnb_ appears in SCOPe 2.07