Lineage for d5ofnb_ (5ofn B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016254Fold a.262: PriB N-terminal domain-like [140913] (1 superfamily)
    multihelical bundle; contains buried central helix; also includes the PriA interface-forming insert subdomain (alpha+beta)
  4. 2016255Superfamily a.262.1: PriB N-terminal domain-like [140914] (1 family) (S)
  5. 2016256Family a.262.1.1: PriB N-terminal domain-like [140915] (2 protein domains)
  6. 2298845Protein automated matches [342146] (1 species)
    not a true protein
  7. 2298846Species Sulfolobus solfataricus [TaxId:2287] [342147] (1 PDB entry)
  8. 2298847Domain d5ofnb_: 5ofn B: [342148]
    Other proteins in same PDB: d5ofna_
    automated match to d1zt2b1
    complexed with zn

Details for d5ofnb_

PDB Entry: 5ofn (more details), 3.01 Å

PDB Description: crystal structure of the heterotrimeric prislx primase from s. solfataricus.
PDB Compounds: (B:) DNA primase large subunit PriL,PriL-X fusion protein

SCOPe Domain Sequences for d5ofnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ofnb_ a.262.1.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
ldvkkypfikslddelkkygggitltdlllnsttlidqakdriqktksgdelphyvsyne
pvlvfyttllslailndvklirryayaeakqfrsllhteneenlleisklldlkinrcdp
ikfylekkrriiqkefcvhfidylkytkdlkedwklsgqilhkgyvyldknqligliaes
ikskivemirplnlkeipeklkslie

SCOPe Domain Coordinates for d5ofnb_:

Click to download the PDB-style file with coordinates for d5ofnb_.
(The format of our PDB-style files is described here.)

Timeline for d5ofnb_:

  • d5ofnb_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-30