Lineage for d5owia1 (5owi A:1-131)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214506Fold d.241: Ribosome binding domain-like [100965] (2 superfamilies)
    beta-(2)-alpha(2)-beta(2); 2 layers: beta/alpha; antiparallel beta-sheet: order 1243; topological similarity to the common core of ribosomal proteins L23 and L15e
  4. 2214518Superfamily d.241.2: Trigger factor ribosome-binding domain [102735] (2 families) (S)
    automatically mapped to Pfam PF05697
  5. 2214533Family d.241.2.0: automated matches [256436] (1 protein)
    not a true family
  6. 2214534Protein automated matches [256437] (2 species)
    not a true protein
  7. 2298829Species Escherichia coli [TaxId:562] [342130] (2 PDB entries)
  8. 2298839Domain d5owia1: 5owi A:1-131 [342140]
    Other proteins in same PDB: d5owia2, d5owia3, d5owib2, d5owib3
    automated match to d1w26a2

Details for d5owia1

PDB Entry: 5owi (more details)

PDB Description: the dynamic dimer structure of the chaperone trigger factor (conformer 1)
PDB Compounds: (A:) Trigger Factor

SCOPe Domain Sequences for d5owia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5owia1 d.241.2.0 (A:1-131) automated matches {Escherichia coli [TaxId: 562]}
mqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkvpmnivaqryga
svrqdvlgdlmsrnfidaiikekinpagaptyvpgeyklgedftysvefevypevelqgl
eaievekpive

SCOPe Domain Coordinates for d5owia1:

Click to download the PDB-style file with coordinates for d5owia1.
(The format of our PDB-style files is described here.)

Timeline for d5owia1:

  • d5owia1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-30