Lineage for d5ouhe_ (5ouh E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408112Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 protein domains)
    automatically mapped to Pfam PF02931
  6. 2408206Protein automated matches [190922] (2 species)
    not a true protein
  7. 2408493Species Human (Homo sapiens) [TaxId:9606] [189722] (4 PDB entries)
  8. 2408498Domain d5ouhe_: 5ouh E: [342139]
    automated match to d5afna_
    complexed with bma, dms, l0b, man, nag

Details for d5ouhe_

PDB Entry: 5ouh (more details), 2.5 Å

PDB Description: humanized alpha-achbp (acetylcholine binding protein) in complex with lobeline.
PDB Compounds: (E:) acetylcholine binding protein

SCOPe Domain Sequences for d5ouhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ouhe_ b.96.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvviwlqmswt
dhylqwnvseypgvkqvsvpisslwkpdillynaierpevltpqlalvnssghvqylpsi
rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
serfyecckepypdvtftvtfrkkg

SCOPe Domain Coordinates for d5ouhe_:

Click to download the PDB-style file with coordinates for d5ouhe_.
(The format of our PDB-style files is described here.)

Timeline for d5ouhe_: