Lineage for d5owja3 (5owj A:248-432)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015621Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 2015622Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (3 families) (S)
    there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family)
  5. 2015641Family a.223.1.0: automated matches [256442] (1 protein)
    not a true family
  6. 2015642Protein automated matches [256443] (2 species)
    not a true protein
  7. 2298832Species Escherichia coli [TaxId:562] [342133] (2 PDB entries)
  8. 2298836Domain d5owja3: 5owj A:248-432 [342137]
    Other proteins in same PDB: d5owja1, d5owja2, d5owjb1, d5owjb2
    automated match to d1w26a1

Details for d5owja3

PDB Entry: 5owj (more details)

PDB Description: the dynamic dimer structure of the chaperone trigger factor (conformer 2)
PDB Compounds: (A:) Trigger Factor

SCOPe Domain Sequences for d5owja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5owja3 a.223.1.0 (A:248-432) automated matches {Escherichia coli [TaxId: 562]}
ltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandidvpaali
dseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnelkadeerv
kglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtekettfnel
mnqqa

SCOPe Domain Coordinates for d5owja3:

Click to download the PDB-style file with coordinates for d5owja3.
(The format of our PDB-style files is described here.)

Timeline for d5owja3:

  • d5owja3 appears in periodic updates to SCOPe 2.06 starting on 2017-11-30