Lineage for d5oxca_ (5oxc A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508387Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2508388Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2508389Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2508715Protein automated matches [190406] (18 species)
    not a true protein
  7. 2509053Species Vaccinia virus [TaxId:10245] [342120] (1 PDB entry)
  8. 2509054Domain d5oxca_: 5oxc A: [342121]
    automated match to d3st3a_

Details for d5oxca_

PDB Entry: 5oxc (more details), 1.02 Å

PDB Description: structure of cerulean fluorescent protein at 1.02 angstrom resolution
PDB Compounds: (A:) egfp

SCOPe Domain Sequences for d5oxca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oxca_ d.22.1.1 (A:) automated matches {Vaccinia virus [TaxId: 10245]}
mvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
lvttlxvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynaisdnvyitadkqkngikanfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagitl

SCOPe Domain Coordinates for d5oxca_:

Click to download the PDB-style file with coordinates for d5oxca_.
(The format of our PDB-style files is described here.)

Timeline for d5oxca_: