Lineage for d6bk1a_ (6bk1 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483347Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2483348Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2483853Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2483854Protein automated matches [190965] (28 species)
    not a true protein
  7. 2483948Species Oryza sativa [TaxId:39947] [324764] (7 PDB entries)
  8. 2483950Domain d6bk1a_: 6bk1 A: [342119]
    automated match to d2pq6a1
    complexed with udp

Details for d6bk1a_

PDB Entry: 6bk1 (more details), 1.58 Å

PDB Description: crystal structure of os79 t291v from o. sativa in complex with udp.
PDB Compounds: (A:) UDP-glycosyltransferase 79

SCOPe Domain Sequences for d6bk1a_:

Sequence, based on SEQRES records: (download)

>d6bk1a_ c.87.1.0 (A:) automated matches {Oryza sativa [TaxId: 39947]}
qvlllpfpaaqghtnpmlqfgrrlayhglrptlvttryvlsttpppgdpfrvaaisdgfd
dasgmaalpdpgeylrtleahgartlaelllsearagrparvlvydphlpwarrvaraag
vataaflsqpcavdliygevcarrlalpvtptdarglyargvlgvelgpddvppfvaape
ltpafceqsieqfagleddddvlvnsfsdlepkeaaymestwraktigpslpsfylddgr
lrsntaygfnlfrstvpcmewldkqpprsvvlvsygvvstfdvakleelgnglcnsgkpf
lwvvrsneehklsvqlrkkcekrglivpfcpqlevlahkatgcflshcgwnstleaivng
vplvamphwadqptiskyveslwgmgvrvqldksgilqreevercirevmdgdrkedyrr
natrlmkkakesmqeggssdkniaefaakys

Sequence, based on observed residues (ATOM records): (download)

>d6bk1a_ c.87.1.0 (A:) automated matches {Oryza sativa [TaxId: 39947]}
qvlllpfpaaqghtnpmlqfgrrlayhglrptlvttryvlsttpppgdpfrvaaisdgfd
dasgmaalpdpgeylrtleahgartlaelllsearagrparvlvydphlpwarrvaraag
vataaflsqpcavdliygevcarrlalpvtptdarglyargvlgvelgpddvppfvaape
ltpafceqsieqfagleddddvlvnsfsdlepkeaaymestwraktigpslpsfylddgr
frstvpcmewldkqpprsvvlvsygvvstfdvakleelgnglcnsgkpflwvvrsneehk
lsvqlrkkcekrglivpfcpqlevlahkatgcflshcgwnstleaivngvplvamphwad
qptiskyveslwgmgvrvqldksgilqreevercirevmdgdrkedyrrnatrlmkkake
smqeggssdkniaefaakys

SCOPe Domain Coordinates for d6bk1a_:

Click to download the PDB-style file with coordinates for d6bk1a_.
(The format of our PDB-style files is described here.)

Timeline for d6bk1a_: