Lineage for d5ol2b_ (5ol2 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2106293Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2106562Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2106563Protein automated matches [190116] (24 species)
    not a true protein
  7. 2298801Species Clostridioides difficile [TaxId:1496] [342102] (1 PDB entry)
  8. 2298809Domain d5ol2b_: 5ol2 B: [342110]
    Other proteins in same PDB: d5ol2c1, d5ol2c2, d5ol2f1, d5ol2f2
    automated match to d4l2ib_
    complexed with ca, cos, fad

Details for d5ol2b_

PDB Entry: 5ol2 (more details), 3.1 Å

PDB Description: the electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile
PDB Compounds: (B:) Electron transfer flavoprotein small subunit

SCOPe Domain Sequences for d5ol2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ol2b_ c.26.2.0 (B:) automated matches {Clostridioides difficile [TaxId: 1496]}
mnivvcikqvpdttevkldpntgtlirdgvpsiinpddkagleeaiklkeemgahvtvit
mgppqadmalkealamgadrgilltdrafagadtwatssalagalknidfdiiiagrqai
dgdtaqvgpqiaehlnlpsityaeeiktegeyvlvkrqfedcchdlkvkmpclittlkdm
ntprymkvgriydafendvvetwtvkdievdpsnlglkgsptsvfksftksvkpagtiyn
edaktsagiiidklkekyii

SCOPe Domain Coordinates for d5ol2b_:

Click to download the PDB-style file with coordinates for d5ol2b_.
(The format of our PDB-style files is described here.)

Timeline for d5ol2b_:

  • d5ol2b_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-30