SCOPe 2.06: Domain d5ol2f2: 5ol2 F:228-378

Lineage for d5ol2f2 (5ol2 F:228-378)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (26 species)
   not a true protein

7. Species Clostridioides difficile [TaxId:1496] [342108] (1 PDB entry)

8. Domain d5ol2f2: 5ol2 F:228-378 [342109]
   Other proteins in same PDB: d5ol2b_, d5ol2c1, d5ol2e_, d5ol2f1
   automated match to d4l1fa2
   complexed with ca, cos, fad

Details for d5ol2f2

PDB Entry: 5ol2, 3.1 Å

PDB Description: the electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile

PDB Compounds: (F:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5ol2f2:

Sequence; same for both SEQRES and ATOM records:

>d5ol2f2 a.29.3.0 (F:228-378) automated matches {Clostridioides difficile [TaxId: 1496]}
gqgfkiamstldggrigiaaqalglaqgaldetvkyvkervqfgrplskfqntqfqladm
evkvqaarhlvyqaainkdlgkpygveaamaklfaaetamevttkavqlhggygytrdyp
vermmrdakiteiyegtsevqrmvisgkllk

Timeline for d5ol2f2:

• d5ol2f2 is new in SCOPe 2.06-stable
  
• d5ol2f2 appears in SCOPe 2.07
  
• d5ol2f2 appears in the current release, SCOPe 2.08