Lineage for d5ol2f2 (5ol2 F:228-378)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992885Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1993019Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1993020Protein automated matches [226935] (26 species)
    not a true protein
  7. 2298807Species Clostridioides difficile [TaxId:1496] [342108] (1 PDB entry)
  8. 2298808Domain d5ol2f2: 5ol2 F:228-378 [342109]
    Other proteins in same PDB: d5ol2b_, d5ol2c1, d5ol2e_, d5ol2f1
    automated match to d4l1fa2
    complexed with ca, cos, fad

Details for d5ol2f2

PDB Entry: 5ol2 (more details), 3.1 Å

PDB Description: the electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile
PDB Compounds: (F:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5ol2f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ol2f2 a.29.3.0 (F:228-378) automated matches {Clostridioides difficile [TaxId: 1496]}
gqgfkiamstldggrigiaaqalglaqgaldetvkyvkervqfgrplskfqntqfqladm
evkvqaarhlvyqaainkdlgkpygveaamaklfaaetamevttkavqlhggygytrdyp
vermmrdakiteiyegtsevqrmvisgkllk

SCOPe Domain Coordinates for d5ol2f2:

Click to download the PDB-style file with coordinates for d5ol2f2.
(The format of our PDB-style files is described here.)

Timeline for d5ol2f2:

  • d5ol2f2 appears in periodic updates to SCOPe 2.06 starting on 2017-11-30