SCOPe 2.06: Domain d5ol2f1: 5ol2 F:1-227

Lineage for d5ol2f1 (5ol2 F:1-227)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (25 species)
   not a true protein

7. Species Clostridioides difficile [TaxId:1496] [342106] (1 PDB entry)

8. Domain d5ol2f1: 5ol2 F:1-227 [342107]
   Other proteins in same PDB: d5ol2b_, d5ol2c2, d5ol2e_, d5ol2f2
   automated match to d4l1fa1
   complexed with ca, cos, fad

Details for d5ol2f1

PDB Entry: 5ol2, 3.1 Å

PDB Description: the electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile

PDB Compounds: (F:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5ol2f1:

Sequence; same for both SEQRES and ATOM records:

>d5ol2f1 e.6.1.0 (F:1-227) automated matches {Clostridioides difficile [TaxId: 1496]}
mdlnskkyqmlkelyvsfaenevkplateldeeerfpyetvekmakagmmgipypkeygg
eggdtvgyimaveelsrvcgttgvilsahtslgswpiyqygneeqkqkflrplasgeklg
afgltepnagtdasgqqttavldgdeyilngskifitnaiagdiyvvmamtdkskgnkgi
safivekgtpgfsfgvkekkmgirgsatselifedcripkenllgke

Timeline for d5ol2f1:

• d5ol2f1 is new in SCOPe 2.06-stable
  
• d5ol2f1 appears in SCOPe 2.07
  
• d5ol2f1 appears in the current release, SCOPe 2.08