Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (25 species) not a true protein |
Species Clostridioides difficile [TaxId:1496] [342106] (1 PDB entry) |
Domain d5ol2f1: 5ol2 F:1-227 [342107] Other proteins in same PDB: d5ol2b_, d5ol2c2, d5ol2e_, d5ol2f2 automated match to d4l1fa1 complexed with ca, cos, fad |
PDB Entry: 5ol2 (more details), 3.1 Å
SCOPe Domain Sequences for d5ol2f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ol2f1 e.6.1.0 (F:1-227) automated matches {Clostridioides difficile [TaxId: 1496]} mdlnskkyqmlkelyvsfaenevkplateldeeerfpyetvekmakagmmgipypkeygg eggdtvgyimaveelsrvcgttgvilsahtslgswpiyqygneeqkqkflrplasgeklg afgltepnagtdasgqqttavldgdeyilngskifitnaiagdiyvvmamtdkskgnkgi safivekgtpgfsfgvkekkmgirgsatselifedcripkenllgke
Timeline for d5ol2f1:
View in 3D Domains from other chains: (mouse over for more information) d5ol2b_, d5ol2c1, d5ol2c2, d5ol2e_ |